PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G1387
Common Nameghmyb9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 264aa    MW: 29597.5 Da    PI: 9.2938
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G1387genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++ +G g+W++ ++  g+ R++k+c++rw +yl
      Gh_A01G1387 14 KGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding60.14.9e-1967111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
      Gh_A01G1387  67 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.723961IPR017930Myb domain
SuperFamilySSF466891.15E-2913108IPR009057Homeodomain-like
SMARTSM007171.9E-131363IPR001005SANT/Myb domain
PfamPF002494.2E-151461IPR001005SANT/Myb domain
CDDcd001673.30E-101661No hitNo description
PROSITE profilePS5129429.41162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-2865116IPR009057Homeodomain-like
SMARTSM007176.3E-1866114IPR001005SANT/Myb domain
PfamPF002493.3E-1767111IPR001005SANT/Myb domain
CDDcd001675.13E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDDRLIAYIR AHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIRRKLLSRG  120
IDPATHRPLN EASQDVTTIS FSGAKEEKEK INTNSNNNPI GFITKAEKRI PVQERCPDLN  180
LDLRISPPYY QQTQPESFKT GGRTLCFICS LGVKNSKDCT CSTITTAAGS SSSSSSHSNS  240
NNSSGYDFLG LKAGILEYRS LEMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.80820.0boll
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO133461930.0
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3362860.0AF336286.1 Gossypium hirsutum GHMYB9 (ghmyb9) mRNA, complete cds.
GenBankFJ1980530.0FJ198053.1 Gossypium barbadense MYB-like protein 3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467554.10.0PREDICTED: myb-related protein 308
SwissprotP813931e-126MYB08_ANTMA; Myb-related protein 308
TrEMBLB6E2S90.0B6E2S9_G
TrEMBLQ9ATD10.0Q9ATD1_G
STRINGPOPTR_0004s18020.11e-136(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.11e-110myb domain protein 4